Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD1 Peptide - C-terminal region

COMMD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf5, MGC27155, MURR1

UniProt

Q8N668

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COMMD1 Rabbit Polyclonal Antibody (orb585086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689729

Preservative

Lyophilized powder

AA Sequence

MNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM25 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-19768R-BF594 100 µL

RBM25 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)
RPU54300-01 50 µg

Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)
RPU54300-02 100 µg

Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)
RPU54300-03 1 mg

Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
ASFV F317L Recombinant Protein
PPT-10017 100 µg

ASFV F317L Recombinant Protein

Sign In for Pricing
View Details
Monkey PS1 (Presenilin 1) ELISA Kit
MBS2504035-01 24 Tests

Monkey PS1 (Presenilin 1) ELISA Kit

Sign In for Pricing
View Details