Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD1 Peptide - C-terminal region

COMMD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf5, MGC27155, MURR1

UniProt

Q8N668

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COMMD1 Rabbit Polyclonal Antibody (orb585086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689729

Preservative

Lyophilized powder

AA Sequence

MNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP1 Rabbit mAb
59981 50 µL

FBP1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1000650-01 0.02 mg (E-Coli)

Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1000650-02 0.02 mg (Yeast)

Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1000650-03 0.1 mg (E-Coli)

Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1000650-04 0.1 mg (Yeast)

Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1000650-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus helveticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details