Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Commd2 Peptide - middle region

Commd2 Peptide - middle region

Product Specifications

Product Name Alternative

Commd2

UniProt

D3ZLN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001102973

Preservative

Lyophilized powder

AA Sequence

SSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILNELAPRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(α S) -α -[[ (9H-Fluoren-9-ylmethoxy) carbonyl]amino]-2-pyridinepropanoic acid 1000mg
A23408-1000 1000 mg

(α S) -α -[[ (9H-Fluoren-9-ylmethoxy) carbonyl]amino]-2-pyridinepropanoic acid 1000mg

Sign In for Pricing
View Details
Anti-AIF AIFM1 Rabbit Monoclonal Antibody, Carrier-free
M01571-carrier-free 100 µL

Anti-AIF AIFM1 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Panc 02.03 SMAD/TGFbeta Reporter (Luc) stable cell line
GTR15423976 1 Vial

Panc 02.03 SMAD/TGFbeta Reporter (Luc) stable cell line

Sign In for Pricing
View Details
KIR3DL1 Rabbit Polyclonal Antibody (BF750)
orb2549934 100 µL

KIR3DL1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Mouse Anti-Mouse H-2Dd, Antibody
GWB-A4103D 0.5 mg

Mouse Anti-Mouse H-2Dd, Antibody

Sign In for Pricing
View Details
CPTII (G-5) Alexa Fluor® 594
sc-377294 AF594 200 µg/mL

CPTII (G-5) Alexa Fluor® 594

Sign In for Pricing
View Details