Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPG Peptide - N-terminal region

COPG Peptide - N-terminal region

Product Specifications

Product Name Alternative

COPG1, FLJ21068, COPG

UniProt

Q9Y678

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPG Rabbit Polyclonal Antibody (orb582719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057212

Preservative

Lyophilized powder

AA Sequence

MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Or52ab2 qPCR Primer Pair
QM64890S 200 Tests

Mouse Or52ab2 qPCR Primer Pair

Sign In for Pricing
View Details
R 568 hydrochloride
B7504-5 5 mg

R 568 hydrochloride

Sign In for Pricing
View Details
Phospho-TAOK 1/2/3 (S181/S181/S177) Recombinant Antibody
bsm-62614R-01 20 µL

Phospho-TAOK 1/2/3 (S181/S181/S177) Recombinant Antibody

Sign In for Pricing
View Details
Phospho-TAOK 1/2/3 (S181/S181/S177) Recombinant Antibody
bsm-62614R-02 100 µL

Phospho-TAOK 1/2/3 (S181/S181/S177) Recombinant Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TRANCE/TNFSF11/RANK L Antibody (12A668) [Janelia Fluor 646]
NB100-56512JF646 0.1 mL

Mouse Monoclonal TRANCE/TNFSF11/RANK L Antibody (12A668) [Janelia Fluor 646]

Sign In for Pricing
View Details
ORM1 Antibody
orb686724-01 50 μL

ORM1 Antibody

Sign In for Pricing
View Details