Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops4 Peptide - N-terminal region

Cops4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC94896

UniProt

Q68FS2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cops4 Rabbit Polyclonal Antibody (orb583339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

CAAW13HP01, 13, 51948518, NP_001004275

Preservative

Lyophilized powder

AA Sequence

VNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC3 Human Gene Knockout Kit (CRISPR)
KN402726 1 Kit

CLIC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLPP Antibody
KC-16852-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-16852-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-16852-03 1 mL

CLPP Antibody

Sign In for Pricing
View Details
C16orf13 (METTL26) Human Gene Knockout Kit (CRISPR)
KN403002 1 Kit

C16orf13 (METTL26) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GNAZ (NM_002073) Human Recombinant Protein
TP761413 50 µg

GNAZ (NM_002073) Human Recombinant Protein

Sign In for Pricing
View Details