Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops4 Peptide - N-terminal region

Cops4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC94896

UniProt

Q68FS2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cops4 Rabbit Polyclonal Antibody (orb583339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

CAAW13HP01, 13, 51948518, NP_001004275

Preservative

Lyophilized powder

AA Sequence

VNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf57 Human Gene Knockout Kit (CRISPR)
KN421811 1 Kit

C7orf57 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NR5A2 (NM_003822) Human Over-expression Lysate
LC401255 20 µg

NR5A2 (NM_003822) Human Over-expression Lysate

Sign In for Pricing
View Details
Muscone
TRC-M815090-500MG 500 mg

Muscone

Sign In for Pricing
View Details
RhoA Recombinant Rabbit Monoclonal Antibody [SN0612]
ET1611-10 100 µL

RhoA Recombinant Rabbit Monoclonal Antibody [SN0612]

Sign In for Pricing
View Details
c-Myc (MYC) Rabbit Polyclonal Antibody
AP06238PU-N 100 µg

c-Myc (MYC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant PAK3 Monoclonal Antibody
AN301617L-01 50 µL

Recombinant PAK3 Monoclonal Antibody

Sign In for Pricing
View Details