Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS8 Peptide - middle region

COPS8 Peptide - middle region

Product Specifications

Product Name Alternative

COP9, CSN8, MGC1297, MGC43256, SGN8

UniProt

Q99627

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPS8 Rabbit Polyclonal Antibody (orb581631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006701

Preservative

Lyophilized powder

AA Sequence

TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPACA7 Rabbit Polyclonal Antibody
orb3069081-01 30 µL

SPACA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPACA7 Rabbit Polyclonal Antibody
orb3069081-02 50 µL

SPACA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPACA7 Rabbit Polyclonal Antibody
orb3069081-03 100 µL

SPACA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPACA7 Rabbit Polyclonal Antibody
orb3069081-04 200 µL

SPACA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human I-309/ CCL1/ TCA-3 Protein, Untagged, E.coli-250ug
QP10223-ec-250ug 250ug

Recombinant Human I-309/ CCL1/ TCA-3 Protein, Untagged, E.coli-250ug

Sign In for Pricing
View Details
NRG1 B1
cyt-733-01 10µg

NRG1 B1

Sign In for Pricing
View Details