COPS8 Peptide - middle region
COPS8 Peptide - middle region
Product Specifications
Product Name Alternative
COP9, CSN8, MGC1297, MGC43256, SGN8
UniProt
Q99627
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COPS8 Rabbit Polyclonal Antibody (orb581631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006701
Preservative
Lyophilized powder
AA Sequence
TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
491964 100 µL
SLC25A29 (Mitochondrial Carnitine/acylcarnitine Carrier Protein CACL, Solute Carrier Family 25 (Mitochondrial Carnitine/acylcarnitine Carrier), Member 29)
Sign In for Pricing
View Details 
CCC58097-01 50 mg
1- (5-Fluoropyridin-2-yl) cyclopropane-1-carbonitrile
Sign In for Pricing
View Details CCC58097-02 0.5 g
1- (5-Fluoropyridin-2-yl) cyclopropane-1-carbonitrile
Sign In for Pricing
View Details