Coq5 Peptide - N-terminal region
Coq5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC112711, RGD1310857
UniProt
Q4G064
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Coq5 Rabbit Polyclonal Antibody (orb580599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034111
Preservative
Lyophilized powder
AA Sequence
RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402309-500 1x 500 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401063-100 1x 100 µL
VEGF-A (VEGF/1063), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details