Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - C-terminal region

Coro2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780693

Preservative

Lyophilized powder

AA Sequence

FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oncomodulin (OCM)
SIPH436Hu01-01 10 µg

Recombinant Oncomodulin (OCM)

Sign In for Pricing
View Details
Recombinant Oncomodulin (OCM)
SIPH436Hu01-02 50 µg

Recombinant Oncomodulin (OCM)

Sign In for Pricing
View Details
Recombinant Oncomodulin (OCM)
SIPH436Hu01-03 200 µg

Recombinant Oncomodulin (OCM)

Sign In for Pricing
View Details
Recombinant Oncomodulin (OCM)
SIPH436Hu01-04 1 mg

Recombinant Oncomodulin (OCM)

Sign In for Pricing
View Details
Recombinant Oncomodulin (OCM)
SIPH436Hu01-05 5 mg

Recombinant Oncomodulin (OCM)

Sign In for Pricing
View Details
CRE stable cells with Blasticidin marker
SC004-Bsd 2x 10^6 Cell/mL - 1 mL

CRE stable cells with Blasticidin marker

Sign In for Pricing
View Details