Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX18 Peptide - middle region

COX18 Peptide - middle region

Product Specifications

Product Name Alternative

COX18HS, FLJ38991, MGC126733

UniProt

Q8N8Q8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX18 Rabbit Polyclonal Antibody (orb582852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776188

Preservative

Lyophilized powder

AA Sequence

LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERKL (NM_001030311) Human Over-expression Lysate
LY400410 100 µg

CERKL (NM_001030311) Human Over-expression Lysate

Sign In for Pricing
View Details
IFITM1 Human Gene Knockout Kit (CRISPR)
KN201617LP 1 Kit

IFITM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ptger1 Mouse Gene Knockout Kit (CRISPR)
KN514168 1 Kit

Ptger1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSK 321
TRC-G797305-2.5MG 2.5 mg

GSK 321

Sign In for Pricing
View Details
4930433I11Rik Mouse Gene Knockout Kit (CRISPR)
KN500364 1 Kit

4930433I11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC50 (DNAAF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]
TA504574BM 100 µL

LRRC50 (DNAAF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]

Sign In for Pricing
View Details