Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX18 Peptide - middle region

COX18 Peptide - middle region

Product Specifications

Product Name Alternative

COX18HS, FLJ38991, MGC126733

UniProt

Q8N8Q8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX18 Rabbit Polyclonal Antibody (orb582852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776188

Preservative

Lyophilized powder

AA Sequence

LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Z)-Metominostrobin
TRC-M338758-25MG 25 mg

(Z)-Metominostrobin

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A11]
TA808294AM 100 µL

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A11]

Sign In for Pricing
View Details
Progesterone (6-5E-10B), CF647 conjugate, 0.1mg/mL
BNC470237-100 1x 100 µL

Progesterone (6-5E-10B), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alendronic Acid Monosodium Salt Trihydrate
TRC-A521250-250MG 250 mg

Alendronic Acid Monosodium Salt Trihydrate

Sign In for Pricing
View Details
Fucose BSA Colloidal Gold Conjugate,  10nm
CCG-0004-10 1 mL

Fucose BSA Colloidal Gold Conjugate, 10nm

Sign In for Pricing
View Details
Human IL-10 (Interleukin 10) ELISA Kit
E-EL-H6154-01 24 Tests

Human IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details