Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6A1 Peptide - N-terminal region

COX6A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX6A, COX6AL, MGC104500

UniProt

P12074

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX6A1 Rabbit Polyclonal Antibody (orb579789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004364

Preservative

Lyophilized powder

AA Sequence

VVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit endothelium Selectin (E-Selectin) ELISA Kit
201-09-0100 96 Tests

Rabbit endothelium Selectin (E-Selectin) ELISA Kit

Sign In for Pricing
View Details
Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit
MBS9398446-01 48 Well

Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit

Sign In for Pricing
View Details
Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit
MBS9398446-02 96 Well

Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit

Sign In for Pricing
View Details
Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit
MBS9398446-03 5x 96 Well

Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit

Sign In for Pricing
View Details
Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit
MBS9398446-04 10x 96 Well

Hamster Regulation of Nuclear Pre-Mrna Domain-Containing Protein 2 (RPRD2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Salmonella newport Recombination-associated protein rdgC (rdgC)
MBS1004621-01 0.02 mg (E-Coli)

Recombinant Salmonella newport Recombination-associated protein rdgC (rdgC)

Sign In for Pricing
View Details