Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6A1 Peptide - N-terminal region

COX6A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX6A, COX6AL, MGC104500

UniProt

P12074

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX6A1 Rabbit Polyclonal Antibody (orb579789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004364

Preservative

Lyophilized powder

AA Sequence

VVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Leukotriene B4 Receptor 2 (LTB4R2) ELISA Kit
MBS9378993 Inquire

Cavy Leukotriene B4 Receptor 2 (LTB4R2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Lassa virus Nucleoprotein (N)
orb1649903-01 20 µg

Recombinant Lassa virus Nucleoprotein (N)

Sign In for Pricing
View Details
Recombinant Lassa virus Nucleoprotein (N)
orb1649903-02 100 µg

Recombinant Lassa virus Nucleoprotein (N)

Sign In for Pricing
View Details
Recombinant Lassa virus Nucleoprotein (N)
orb1649903-03 1 mg

Recombinant Lassa virus Nucleoprotein (N)

Sign In for Pricing
View Details
Tpbg ORF Vector (Mouse) (pORF)
ORF060213 1.0 µg DNA

Tpbg ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Carbamoyl-phosphate synthase arginine-specific large chain (CPA2), partial
MBS1365860 Inquire

Recombinant Ashbya gossypii Carbamoyl-phosphate synthase arginine-specific large chain (CPA2), partial

Sign In for Pricing
View Details