Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpa3 Peptide - N-terminal region

Cpa3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MC-CPA, mMC-CPA

UniProt

P15089

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpa3 Rabbit Polyclonal Antibody (orb578295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031779

Preservative

Lyophilized powder

AA Sequence

ILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), 1mg/mL
BNUM2983-50 1x 50 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), 1mg/mL

Sign In for Pricing
View Details
MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]
TA503045AM 100 µL

MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]

Sign In for Pricing
View Details
1,3-Dithietan-2-imine Hydrochloride
TRC-D492405-25MG 25 mg

1,3-Dithietan-2-imine Hydrochloride

Sign In for Pricing
View Details
HRP-conjugated GFP-Tag Monoclonal Antibody
AN00432HP-01 25 µL

HRP-conjugated GFP-Tag Monoclonal Antibody

Sign In for Pricing
View Details
HRP-conjugated GFP-Tag Monoclonal Antibody
AN00432HP-02 100 µL

HRP-conjugated GFP-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Uncoated Human EPO (Erythropoietin) ELISA Kit
E-UNEL-H0044-01 5x 96 Tests

Uncoated Human EPO (Erythropoietin) ELISA Kit

Sign In for Pricing
View Details