Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPA6 Peptide - middle region

CPA6 Peptide - middle region

Product Specifications

Product Name Alternative

CPAH, ETL5, FEB11

UniProt

Q8N4T0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPA6 Rabbit Polyclonal Antibody (orb583549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065094

Preservative

Lyophilized powder

AA Sequence

QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Free Kappa Light Chain,  5nm
GM-100-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free Kappa Light Chain, 5nm

Sign In for Pricing
View Details
Jasmolin I + Cinerin I (Mixture)
TRC-J210495-10MG 10 mg

Jasmolin I + Cinerin I (Mixture)

Sign In for Pricing
View Details
GCS1 (MOGS) (N-term) Rabbit Polyclonal Antibody
AP12152PU-N 400 µL

GCS1 (MOGS) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL
BNC942309-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TentaGel® S PAL
S30022.25G 25 g

TentaGel® S PAL

Sign In for Pricing
View Details
HDAC9 Mouse Monoclonal Antibody [Clone ID: OTI6G4]
CF805309 100 µg

HDAC9 Mouse Monoclonal Antibody [Clone ID: OTI6G4]

Sign In for Pricing
View Details