Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPA6 Peptide - middle region

CPA6 Peptide - middle region

Product Specifications

Product Name Alternative

CPAH, ETL5, FEB11

UniProt

Q8N4T0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPA6 Rabbit Polyclonal Antibody (orb583549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065094

Preservative

Lyophilized powder

AA Sequence

QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 Polyclonal Antibody
E-AB-52141-01 20 µL

CDK4 Polyclonal Antibody

Sign In for Pricing
View Details
CDK4 Polyclonal Antibody
E-AB-52141-02 60 µL

CDK4 Polyclonal Antibody

Sign In for Pricing
View Details
CDK4 Polyclonal Antibody
E-AB-52141-03 120 µL

CDK4 Polyclonal Antibody

Sign In for Pricing
View Details
CDK4 Polyclonal Antibody
E-AB-52141-04 200 µL

CDK4 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS508215 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS709794 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details