Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE3 Peptide - C-terminal region

CPNE3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPN3, KIAA0636, PRO1071

UniProt

Q9NVH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPNE3 Rabbit Polyclonal Antibody (orb585361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060668

Preservative

Lyophilized powder

AA Sequence

QFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNRC6A Pre-designed siRNA Set B
SI017133B 1 Each

Human TNRC6A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)
MBS1306172-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)
MBS1306172-02 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)
MBS1306172-03 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)
MBS1306172-04 0.1 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)
MBS1306172-05 0.02 mg (Baculovirus)

Recombinant Photorhabdus luminescens subsp. laumondii Transaldolase (tal)

Sign In for Pricing
View Details