Cpne5 Peptide - N-terminal region
Cpne5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
A830083G22Rik, MGC47475
UniProt
Q8JZW4
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cpne5 Rabbit Polyclonal Antibody (orb583583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_694806
Preservative
Lyophilized powder
AA Sequence
SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B10]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea1844d/imageurl/ta505733bm.webp)
TA505733BM 100 µL
MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B10]
Sign In for Pricing
View Details 
BNC941058-500 1x 500 µL
Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 