Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne5 Peptide - N-terminal region

Cpne5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A830083G22Rik, MGC47475

UniProt

Q8JZW4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne5 Rabbit Polyclonal Antibody (orb583583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694806

Preservative

Lyophilized powder

AA Sequence

SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
AP06630PU-N 100 µg

Thrombin Receptor (F2R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DEPTOR (NM_022783) Human Over-expression Lysate
LY402946 100 µg

DEPTOR (NM_022783) Human Over-expression Lysate

Sign In for Pricing
View Details
PCDHGA2 (NM_032009) Human Recombinant Protein
TP310863 20 µg

PCDHGA2 (NM_032009) Human Recombinant Protein

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
AP14106PU-N 400 µL

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Calmegin Antibody
RN-12135-01 50 μL

Recombinant Calmegin Antibody

Sign In for Pricing
View Details
Recombinant Calmegin Antibody
RN-12135-02 100 µL

Recombinant Calmegin Antibody

Sign In for Pricing
View Details