Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne6 Peptide - C-terminal region

Cpne6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU067659, BB076446

UniProt

Q9Z140

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne6 Rabbit Polyclonal Antibody (orb584340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034077

Preservative

Lyophilized powder

AA Sequence

YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EB2 (MAPRE2) Human Gene Knockout Kit (CRISPR)
KN400259 1 Kit

EB2 (MAPRE2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL
BNC472400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS627448 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Recombinant Histone H2AX Antibody
RC-5744-01 50 μL

Recombinant Histone H2AX Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX Antibody
RC-5744-02 100 µL

Recombinant Histone H2AX Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX Antibody
RC-5744-03 1 mL

Recombinant Histone H2AX Antibody

Sign In for Pricing
View Details