Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne6 Peptide - C-terminal region

Cpne6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU067659, BB076446

UniProt

Q9Z140

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne6 Rabbit Polyclonal Antibody (orb584340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034077

Preservative

Lyophilized powder

AA Sequence

YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAPCD1 (NM_001039651) Human Over-expression Lysate
LY422099 100 µg

SAPCD1 (NM_001039651) Human Over-expression Lysate

Sign In for Pricing
View Details
ACADSB (NM_001609) Human Over-expression Lysate
LY419848 100 µg

ACADSB (NM_001609) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1e (C-6His)
PKSM041392-01 10 µg

Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1e (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1e (C-6His)
PKSM041392-02 50 µg

Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1e (C-6His)

Sign In for Pricing
View Details
Propoxyphenyl Thioaildenafil
TRC-P831640-5MG 5 mg

Propoxyphenyl Thioaildenafil

Sign In for Pricing
View Details
XRCC3 Antibody
8C0397-AAT 50 µg

XRCC3 Antibody

Sign In for Pricing
View Details