Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE6 Peptide - middle region

CPNE6 Peptide - middle region

Product Specifications

Product Name Alternative

N-COPINE

UniProt

O95741

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPNE6 Rabbit Polyclonal Antibody (orb584339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006023

Preservative

Lyophilized powder

AA Sequence

LPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein CI (APOC1) Rabbit Monoclonal Antibody
TA423670 100 µL

Apolipoprotein CI (APOC1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BCMA (TNFRSF17) Rabbit Polyclonal Antibody
TA382649 100 µL

BCMA (TNFRSF17) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin-Rabbit Anti-Human IgG (H+L)
RD90791A-01 120 μL

Biotin-Rabbit Anti-Human IgG (H+L)

Sign In for Pricing
View Details
Biotin-Rabbit Anti-Human IgG (H+L)
RD90791A-02 500 µL

Biotin-Rabbit Anti-Human IgG (H+L)

Sign In for Pricing
View Details
Biotin-Rabbit Anti-Human IgG (H+L)
RD90791A-03 1 mL

Biotin-Rabbit Anti-Human IgG (H+L)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842Q-01 20 Tests

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details