Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE6 Peptide - middle region

CPNE6 Peptide - middle region

Product Specifications

Product Name Alternative

N-COPINE

UniProt

O95741

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPNE6 Rabbit Polyclonal Antibody (orb584339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006023

Preservative

Lyophilized powder

AA Sequence

LPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Testis
CS803669 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
CF®640R Alkyne
#92091 1x 500 µg

CF®640R Alkyne

Sign In for Pricing
View Details
Killer cell immunoglobULin like receptor 3DL3 (KIR3DL3) Human Gene Knockout Kit (CRISPR)
KN424383 1 Kit

Killer cell immunoglobULin like receptor 3DL3 (KIR3DL3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Double Beam UV Visible Spectrophotometer BSDBU-204-A
BSDBU-204-A Each

Double Beam UV Visible Spectrophotometer BSDBU-204-A

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF568 conjugate, 0.1mg/mL
BNC680726-500 1x 500 µL

DOG-1 (DG1/447 + DOG1.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801233 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details