Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne7 Peptide - C-terminal region

Cpne7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW047065

UniProt

Q0VE82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne7 Rabbit Polyclonal Antibody (orb582606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_733785

Preservative

Lyophilized powder

AA Sequence

GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Alkaline Phosphatase
BP239-10ug 10 µg

Recombinant Alkaline Phosphatase

Sign In for Pricing
View Details
FARP1 Double Nickase Plasmid (m2)
sc-432359-NIC-2 20 µg

FARP1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Pentaerythritol ethoxylate (15/4 EO/OH), 100 % v/v, 100 ML
M-CSS-375 100 mL

Pentaerythritol ethoxylate (15/4 EO/OH), 100 % v/v, 100 ML

Sign In for Pricing
View Details
PITPNB Antibody
MBS8588471-01 0.1 mg

PITPNB Antibody

Sign In for Pricing
View Details
PITPNB Antibody
MBS8588471-02 0.1 mL (AF405L)

PITPNB Antibody

Sign In for Pricing
View Details
PITPNB Antibody
MBS8588471-03 0.1 mL (AF405S)

PITPNB Antibody

Sign In for Pricing
View Details