Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne7 Peptide - C-terminal region

Cpne7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW047065

UniProt

Q0VE82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne7 Rabbit Polyclonal Antibody (orb582606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_733785

Preservative

Lyophilized powder

AA Sequence

GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLBD2 Protein Vector (Human) (pPB-C-His)
PV111730 500 ng

PLBD2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human CUL2 shRNA Plasmid
abx955541-01 150 µg

Human CUL2 shRNA Plasmid

Sign In for Pricing
View Details
Human CUL2 shRNA Plasmid
abx955541-02 300 µg

Human CUL2 shRNA Plasmid

Sign In for Pricing
View Details
DsRNA Mouse Monoclonal Antibody
orb2956752-01 50 µg

DsRNA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DsRNA Mouse Monoclonal Antibody
orb2956752-02 100 µg

DsRNA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DsRNA Mouse Monoclonal Antibody
orb2956752-03 1 mg

DsRNA Mouse Monoclonal Antibody

Sign In for Pricing
View Details