Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPPED1 Peptide - N-terminal region

CPPED1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSTP1, FLJ11151

UniProt

Q9BRF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPPED1 Rabbit Polyclonal Antibody (orb585287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060810

Preservative

Lyophilized powder

AA Sequence

LCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DI-4-ANEPPS
#61010 1x 5 mg

DI-4-ANEPPS

Sign In for Pricing
View Details
Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody
TA368766 100 µL

Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat TSH (Thyroid Stimulating Hormone) CLIA Kit
E-CL-R0647-01 24 Tests

Rat TSH (Thyroid Stimulating Hormone) CLIA Kit

Sign In for Pricing
View Details
Rat TSH (Thyroid Stimulating Hormone) CLIA Kit
E-CL-R0647-02 48 Tests

Rat TSH (Thyroid Stimulating Hormone) CLIA Kit

Sign In for Pricing
View Details
Rat TSH (Thyroid Stimulating Hormone) CLIA Kit
E-CL-R0647-03 96 Tests

Rat TSH (Thyroid Stimulating Hormone) CLIA Kit

Sign In for Pricing
View Details
VGLL2 Human qPCR Primer Pair (NM_153453)
HP218155 200 Reactions

VGLL2 Human qPCR Primer Pair (NM_153453)

Sign In for Pricing
View Details