Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPPED1 Peptide - N-terminal region

CPPED1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSTP1, FLJ11151

UniProt

Q9BRF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPPED1 Rabbit Polyclonal Antibody (orb585287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060810

Preservative

Lyophilized powder

AA Sequence

LCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Antibody
KC-6427-01 50 μL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
KC-6427-02 100 µL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
KC-6427-03 1 mL

STAT3 Antibody

Sign In for Pricing
View Details
SLC38A11 Human qPCR Primer Pair (NM_173512)
HP218332 200 Reactions

SLC38A11 Human qPCR Primer Pair (NM_173512)

Sign In for Pricing
View Details
H10 (H1F0) Human Gene Knockout Kit (CRISPR)
KN401643 1 Kit

H10 (H1F0) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802119 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details