Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPPED1 Peptide - C-terminal region

CPPED1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSTP1, FLJ11151

UniProt

Q9BRF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPPED1 Rabbit Polyclonal Antibody (orb585288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060810

Preservative

Lyophilized powder

AA Sequence

QRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4605R-BF647-01 20 µL

MMP2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MMP2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4605R-BF647-02 100 µL

MMP2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida fmt Protein (aa 1-317)
VAng-Cr6810-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida fmt Protein (aa 1-317)

Sign In for Pricing
View Details
Mouse Monoclonal Protein Z Antibody (OTI4D5) [Alexa Fluor 647]
NBP2-73673AF647 0.1 mL

Mouse Monoclonal Protein Z Antibody (OTI4D5) [Alexa Fluor 647]

Sign In for Pricing
View Details
IL2RG Antibody (Center) Blocking Peptide
MBS9228217-01 0.5 mg

IL2RG Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
IL2RG Antibody (Center) Blocking Peptide
MBS9228217-02 5x 0.5 mg

IL2RG Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details