Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPVL Peptide - middle region

CPVL Peptide - middle region

Product Specifications

Product Name Alternative

HVLP, MGC10029

UniProt

Q9H3G5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPVL Rabbit Polyclonal Antibody (orb585109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112601

Preservative

Lyophilized powder

AA Sequence

NGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 mouse monoclonal antibody, clone MEM-43/5, PE
SM3033R 100 Tests

CD59 mouse monoclonal antibody, clone MEM-43/5, PE

Sign In for Pricing
View Details
Rabbit Polyclonal ITCH/AIP4 Antibody
NBP2-55083-25ul 25 µL

Rabbit Polyclonal ITCH/AIP4 Antibody

Sign In for Pricing
View Details
Human CLEC3B knockdown cell line
ABC-KD3204 1 Vial

Human CLEC3B knockdown cell line

Sign In for Pricing
View Details
Zebrafish MerTKa Rabbit Polyclonal Antibody (PE)
orb2570610 200 µL

Zebrafish MerTKa Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ZNF385 (ZNF385A) (NM_001130967) Human Tagged Lenti ORF Clone
RC225590L4 10 µg

ZNF385 (ZNF385A) (NM_001130967) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PIAS4 Protein Vector (Human) (pPM-C-HA)
PV031235 500 ng

PIAS4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details