Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISPLD1 Peptide - middle region

CRISPLD1 Peptide - middle region

Product Specifications

Product Name Alternative

CRISP10, DKFZp762F133, LCRISP1

UniProt

Q9H336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRISPLD1 Rabbit Polyclonal Antibody (orb326444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113649

Preservative

Lyophilized powder

AA Sequence

YSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), 0.2mg/mL
BNUB3025-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), 0.2mg/mL

Sign In for Pricing
View Details
SIAH1 Rabbit Polyclonal Antibody
AP05260SU-N 100 µg

SIAH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IVD (NM_002225) Human Over-expression Lysate
LC419463 20 µg

IVD (NM_002225) Human Over-expression Lysate

Sign In for Pricing
View Details
Legionella sp. PCR Detection TaqMan Kit Dx
DxTM64400 24 Reactions

Legionella sp. PCR Detection TaqMan Kit Dx

Sign In for Pricing
View Details
uPA (PLAU) Mouse Monoclonal Antibody [Clone ID: OTI6H4]
CF805316 100 µg

uPA (PLAU) Mouse Monoclonal Antibody [Clone ID: OTI6H4]

Sign In for Pricing
View Details
HCK Mouse Monoclonal Antibody [Clone ID: 3D12E10]
AM06200SU-N 100 µL

HCK Mouse Monoclonal Antibody [Clone ID: 3D12E10]

Sign In for Pricing
View Details