Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISPLD1 Peptide - middle region

CRISPLD1 Peptide - middle region

Product Specifications

Product Name Alternative

CRISP10, DKFZp762F133, LCRISP1

UniProt

Q9H336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRISPLD1 Rabbit Polyclonal Antibody (orb326444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113649

Preservative

Lyophilized powder

AA Sequence

YSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPK (TP53RK) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]
TA808230BM 100 µL

PRPK (TP53RK) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA504870AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
2210016F16Rik Mouse Gene Knockout Kit (CRISPR)
KN500216 1 Kit

2210016F16Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCDC157 (NM_001017437) Human Recombinant Protein
TP310351L 1 mg

CCDC157 (NM_001017437) Human Recombinant Protein

Sign In for Pricing
View Details
TBL2 (N-term) Rabbit Polyclonal Antibody
AP54181PU-N 400 µL

TBL2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS630308 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details