Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRK Peptide - C-terminal region

CRK Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRKII, p38

UniProt

P46108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRK Rabbit Polyclonal Antibody (orb573637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058431

Preservative

Lyophilized powder

AA Sequence

IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC22 Recombinant Protein (Human)
RP005908 100 µg

CCDC22 Recombinant Protein (Human)

Sign In for Pricing
View Details
Canine Brain-gut peptides ELISA Kit
MBS755068-01 48 Well

Canine Brain-gut peptides ELISA Kit

Sign In for Pricing
View Details
Canine Brain-gut peptides ELISA Kit
MBS755068-02 96 Well

Canine Brain-gut peptides ELISA Kit

Sign In for Pricing
View Details
Canine Brain-gut peptides ELISA Kit
MBS755068-03 5x 96 Well

Canine Brain-gut peptides ELISA Kit

Sign In for Pricing
View Details
Canine Brain-gut peptides ELISA Kit
MBS755068-04 10x 96 Well

Canine Brain-gut peptides ELISA Kit

Sign In for Pricing
View Details
Canine Smooth muscle actin (SMA) ELISA Kit
MBS2607746-01 48 Well

Canine Smooth muscle actin (SMA) ELISA Kit

Sign In for Pricing
View Details