Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF1 Peptide - middle region

CRLF1 Peptide - middle region

Product Specifications

Product Name Alternative

CISS, CISS1, CLF, CLF-1, NR6, zcytor5

UniProt

O75462

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRLF1 Rabbit Polyclonal Antibody (orb576064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004741

Preservative

Lyophilized powder

AA Sequence

KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17Alpha-Boldenone-d3 17-O-(4-Nitrobenzoate)
TRC-B675132-25MG 25 mg

17Alpha-Boldenone-d3 17-O-(4-Nitrobenzoate)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800692 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
MCM10 (NM_018518) Human Over-expression Lysate
LY402694 100 µg

MCM10 (NM_018518) Human Over-expression Lysate

Sign In for Pricing
View Details
Sodium Chondroitin Sulfate A
TRC-S699343-5G 5 g

Sodium Chondroitin Sulfate A

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF640R conjugate, 0.1mg/mL
BNC400521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 Rabbit Polyclonal Antibody
TA382093 100 µL

STAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details