Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF1 Peptide - middle region

CRLF1 Peptide - middle region

Product Specifications

Product Name Alternative

CISS, CISS1, CLF, CLF-1, NR6, zcytor5

UniProt

O75462

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRLF1 Rabbit Polyclonal Antibody (orb576064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004741

Preservative

Lyophilized powder

AA Sequence

KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA12 Antibody
8C14935-AAT 50 µg

CA12 Antibody

Sign In for Pricing
View Details
SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5A12]
CF808492 100 µg

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5A12]

Sign In for Pricing
View Details
L-Dehydro Ascorbic Acid-13C6
TRC-D229252-5MG 5 mg

L-Dehydro Ascorbic Acid-13C6

Sign In for Pricing
View Details
GJB1 (NM_001097642) Human Over-expression Lysate
LY420416 100 µg

GJB1 (NM_001097642) Human Over-expression Lysate

Sign In for Pricing
View Details
Automatic Tissue Processor BHTP-308
BHTP-308 1 Unit

Automatic Tissue Processor BHTP-308

Sign In for Pricing
View Details
TRMT2B (N-term) Rabbit Polyclonal Antibody
AP54358PU-N 400 µL

TRMT2B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details