Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF2 Peptide - middle region

CRLF2 Peptide - middle region

Product Specifications

Product Name Alternative

CRL2, CRLF2Y, TSLPR

UniProt

Q5G7M1

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRLF2 Rabbit Polyclonal Antibody (orb579231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012288

Preservative

Lyophilized powder

AA Sequence

FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND6P18 Protein Vector (Human) (pPB-C-His)
PV102726 500 ng

MTND6P18 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat Tmprss2 Pre-designed siRNA Set B
SI214909B 1 Each

Rat Tmprss2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PLA2R antibody
orb3016957 1 mL

PLA2R antibody

Sign In for Pricing
View Details
REXO2 Antibody
PT-A04741-01 5 µg

REXO2 Antibody

Sign In for Pricing
View Details
REXO2 Antibody
PT-A04741-02 20 µg

REXO2 Antibody

Sign In for Pricing
View Details
REXO2 Antibody
PT-A04741-03 100 µg

REXO2 Antibody

Sign In for Pricing
View Details