Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF2 Peptide - middle region

CRLF2 Peptide - middle region

Product Specifications

Product Name Alternative

CRL2, CRLF2Y, TSLPR

UniProt

Q5G7M1

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRLF2 Rabbit Polyclonal Antibody (orb579231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012288

Preservative

Lyophilized powder

AA Sequence

FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX4 Protein Vector (Human) (pPM-C-His)
PV040712 500 ng

STX4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ZN490 Rabbit Polyclonal Antibody
JOT-AP05693-01 20 µL

ZN490 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN490 Rabbit Polyclonal Antibody
JOT-AP05693-02 50 μL

ZN490 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN490 Rabbit Polyclonal Antibody
JOT-AP05693-03 100 µL

ZN490 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TREH, N-His
ARO-P14292-01 50 µg

Recombinant Human TREH, N-His

Sign In for Pricing
View Details
Recombinant Human TREH, N-His
ARO-P14292-02 100 µg

Recombinant Human TREH, N-His

Sign In for Pricing
View Details