Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRP Peptide - N-terminal region

CRP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC149895, MGC88244, PTX1

UniProt

P02741

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRP Rabbit Polyclonal Antibody (orb578209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000558

Preservative

Lyophilized powder

AA Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMOD1 Recombinant Protein (Human)
RP017923 100 µg

LMOD1 Recombinant Protein (Human)

Sign In for Pricing
View Details
PDE4D Rabbit Polyclonal Antibody (Cy5)
orb910186 100 µL

PDE4D Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
CleriGar™ Plant Culture Tested
PCT0902-1KG 1 Kg

CleriGar™ Plant Culture Tested

Sign In for Pricing
View Details
TIGD1 Antibody
orb1333107 100 µg

TIGD1 Antibody

Sign In for Pricing
View Details
Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit
RD-a1AGP-b-01 96 Tests

Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit

Sign In for Pricing
View Details
Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit
RD-a1AGP-b-02 48 Tests

Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit

Sign In for Pricing
View Details