Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRP Peptide - N-terminal region

CRP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC149895, MGC88244, PTX1

UniProt

P02741

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRP Rabbit Polyclonal Antibody (orb578209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000558

Preservative

Lyophilized powder

AA Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Sorting Nexin 13 ELISA Kit
MBS097083-01 48 Well

Canine Sorting Nexin 13 ELISA Kit

Sign In for Pricing
View Details
Canine Sorting Nexin 13 ELISA Kit
MBS097083-02 96 Well

Canine Sorting Nexin 13 ELISA Kit

Sign In for Pricing
View Details
Canine Sorting Nexin 13 ELISA Kit
MBS097083-03 5x 96 Well

Canine Sorting Nexin 13 ELISA Kit

Sign In for Pricing
View Details
Canine Sorting Nexin 13 ELISA Kit
MBS097083-04 10x 96 Well

Canine Sorting Nexin 13 ELISA Kit

Sign In for Pricing
View Details
Purified Anti-Human CD40 Antibody
JOT22252F 25μg

Purified Anti-Human CD40 Antibody

Sign In for Pricing
View Details
TNNI3 Antibody Blocking peptide
orb1454058 500 µg

TNNI3 Antibody Blocking peptide

Sign In for Pricing
View Details