Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY1 Peptide - N-terminal region

CRY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHLL1

UniProt

Q16526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004066

Preservative

Lyophilized powder

AA Sequence

KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tin (II) telluride, 99.999%
GX9560-50g 50 g

Tin (II) telluride, 99.999%

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)
MBS7008997-01 0.02 mg

Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)
MBS7008997-02 0.1 mg

Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)
MBS7008997-03 5x 0.1 mg

Recombinant Xanthobacter autotrophicus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
RD-ECF-b-01 96 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
RD-ECF-b-02 48 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details