Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY1 Peptide - N-terminal region

CRY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHLL1

UniProt

Q16526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004066

Preservative

Lyophilized powder

AA Sequence

KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monocyte chemotactic protein 4 (MCP-4) ELISA Kit
orb1668499-01 48 Tests

Human Monocyte chemotactic protein 4 (MCP-4) ELISA Kit

Sign In for Pricing
View Details
Human Monocyte chemotactic protein 4 (MCP-4) ELISA Kit
orb1668499-02 96 Tests

Human Monocyte chemotactic protein 4 (MCP-4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human FBLN1 Protein, N-His
orb2968888-01 50 µg

Recombinant Human FBLN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FBLN1 Protein, N-His
orb2968888-02 100 µg

Recombinant Human FBLN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FBLN1 Protein, N-His
orb2968888-03 1 mg

Recombinant Human FBLN1 Protein, N-His

Sign In for Pricing
View Details
Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 PE/Cyanine7 Ready To Use 200 Tests
IRTAMSCD1D19G11CPECY7200 200 Tests

Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 PE/Cyanine7 Ready To Use 200 Tests

Sign In for Pricing
View Details