Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY2 Peptide - N-terminal region

CRY2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10332, HCRY2, KIAA0658, PHLL2

UniProt

Q49AN0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRY2 Rabbit Polyclonal Antibody (orb581689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066940

Preservative

Lyophilized powder

AA Sequence

IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5.5 Anti-Mouse CD106 Antibody
RD21046F-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD106 Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD106 Antibody
RD21046F-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD106 Antibody

Sign In for Pricing
View Details
RIM2 (RIMS2) (NM_001282881) Human Tagged ORF Clone
RG240034 10 µg

RIM2 (RIMS2) (NM_001282881) Human Tagged ORF Clone

Sign In for Pricing
View Details
Polystyrene Sieber Resin
H10024.100G 100 g

Polystyrene Sieber Resin

Sign In for Pricing
View Details
GDI1 Mouse Monoclonal Antibody [Clone ID: OTI8A3]
CF811044 100 µg

GDI1 Mouse Monoclonal Antibody [Clone ID: OTI8A3]

Sign In for Pricing
View Details
LRAT Rabbit Polyclonal Antibody
TA378113 100 µL

LRAT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details