CRY2 Peptide - N-terminal region
CRY2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ10332, HCRY2, KIAA0658, PHLL2
UniProt
Q49AN0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRY2 Rabbit Polyclonal Antibody (orb581689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066940
Preservative
Lyophilized powder
AA Sequence
IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TNFRSF18 Mouse Monoclonal Antibody [Clone ID: OTI5G4]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9081af/imageurl/cf806401.webp)
CF806401 100 µg
TNFRSF18 Mouse Monoclonal Antibody [Clone ID: OTI5G4]
Sign In for Pricing
View Details 
11100-AAT 200 Tests
Amplite® Fluorimetric Fluorescamine Protein Quantitation Kit *Blue Fluorescence*
Sign In for Pricing
View Details 
HA750568 100 µL
Histone H4 (acetyl K8) Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details