Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF2RB Peptide - C-terminal region

CSF2RB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD131, CDw131, IL3RB, IL5RB, SMDP5

UniProt

P32927

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSF2RB Rabbit Polyclonal Antibody (orb585667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000386

Preservative

Lyophilized powder

AA Sequence

HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ7 Antibody
KC-34670-01 50 μL

COQ7 Antibody

Sign In for Pricing
View Details
COQ7 Antibody
KC-34670-02 100 µL

COQ7 Antibody

Sign In for Pricing
View Details
COQ7 Antibody
KC-34670-03 1 mL

COQ7 Antibody

Sign In for Pricing
View Details
Phospho-BTK (Tyr223) Antibody
FNab09846 100 µg

Phospho-BTK (Tyr223) Antibody

Sign In for Pricing
View Details
PPP1R10 (NM_002714) Human Over-expression Lysate
LC419150 20 µg

PPP1R10 (NM_002714) Human Over-expression Lysate

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), 0.2mg/mL
BNUB0014-100 1x 100 µL

CD31 / PECAM-1 (C31.7), 0.2mg/mL

Sign In for Pricing
View Details