Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF2RB Peptide - C-terminal region

CSF2RB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD131, CDw131, IL3RB, IL5RB, SMDP5

UniProt

P32927

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSF2RB Rabbit Polyclonal Antibody (orb585667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000386

Preservative

Lyophilized powder

AA Sequence

HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TuLP2 (NM_003323) Human Over-expression Lysate
LY418766 100 µg

TuLP2 (NM_003323) Human Over-expression Lysate

Sign In for Pricing
View Details
Vinculin (VCL) (C-term) Rabbit Polyclonal Antibody
AP14071PU-N 400 µL

Vinculin (VCL) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MGCD 516
TRC-M340970-1G 1 g

MGCD 516

Sign In for Pricing
View Details
NOX5 (NM_024505) Human Over-expression Lysate
LC402996 20 µg

NOX5 (NM_024505) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805396 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
FAM50A Rabbit Monoclonal Antibody [Clone ID: R08-2G7]
TA421939 100 µL

FAM50A Rabbit Monoclonal Antibody [Clone ID: R08-2G7]

Sign In for Pricing
View Details