Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSH2 Peptide - middle region

CSH2 Peptide - middle region

Product Specifications

Product Name Alternative

CS-2, CSB, hCS-B

UniProt

B1A4H9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSH2 Rabbit Polyclonal Antibody (orb325738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072171

Preservative

Lyophilized powder

AA Sequence

LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR6 (CENPV) Human Gene Knockout Kit (CRISPR)
KN212747BN 1 Kit

PRR6 (CENPV) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lanthanum Nitrate Hexahydrate
TRC-L175058-5G 5 g

Lanthanum Nitrate Hexahydrate

Sign In for Pricing
View Details
LMOD2 Human Gene Knockout Kit (CRISPR)
KN420697 1 Kit

LMOD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)
PDMM100150-01 20 µg

Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)
PDMM100150-02 100 µg

Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)
PDMM100150-03 500 µg

Recombinant Mouse CD27/TNFRSF7 Protein (Fc Tag)

Sign In for Pricing
View Details