Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSK Peptide - middle region

CSK Peptide - middle region

Product Specifications

Product Name Alternative

MGC117393

UniProt

P41240

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSK Rabbit Polyclonal Antibody (orb330655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004374

Preservative

Lyophilized powder

AA Sequence

SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hnRNP U (HNRNPU) (NM_004501) AAV Particle
RC201627A1V 250 µL

Human hnRNP U (HNRNPU) (NM_004501) AAV Particle

Sign In for Pricing
View Details
SP-D shRNA (m) Lentiviral Particles
sc-36542-V 200 µL

SP-D shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Collagen VI Rabbit mAb
MBS9470044-01 0.05 mL

Collagen VI Rabbit mAb

Sign In for Pricing
View Details
Collagen VI Rabbit mAb
MBS9470044-02 0.1 mL

Collagen VI Rabbit mAb

Sign In for Pricing
View Details
Collagen VI Rabbit mAb
MBS9470044-03 5x 0.1 mL

Collagen VI Rabbit mAb

Sign In for Pricing
View Details
SEL1L Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV696588 1.0 µg DNA

SEL1L Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details