Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSK Peptide - middle region

CSK Peptide - middle region

Product Specifications

Product Name Alternative

MGC117393

UniProt

P41240

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSK Rabbit Polyclonal Antibody (orb330655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004374

Preservative

Lyophilized powder

AA Sequence

SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RFPL4B qPCR Primer Pair
QH79125S 200 Tests

Human RFPL4B qPCR Primer Pair

Sign In for Pricing
View Details
Gliomedin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-11032R-BF350 100 µL

Gliomedin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Hederacoside D
HY-N0254-01 5 mg

Hederacoside D

Sign In for Pricing
View Details
Hederacoside D
HY-N0254-02 10 mg

Hederacoside D

Sign In for Pricing
View Details
Hederacoside D
HY-N0254-03 10 mM - 1 mL

Hederacoside D

Sign In for Pricing
View Details
Hederacoside D
HY-N0254-04 25 mg

Hederacoside D

Sign In for Pricing
View Details