Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSN3 Peptide - N-terminal region

CSN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSN10, CSNK, KCA

UniProt

P07498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSN3 Rabbit Polyclonal Antibody (orb581556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005203

Preservative

Lyophilized powder

AA Sequence

MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fas/TNFRSF6/CD95 Antibody (MM0041-12J3) [DyLight 680]
NB110-61007FR 0.1 mL

Mouse Monoclonal Fas/TNFRSF6/CD95 Antibody (MM0041-12J3) [DyLight 680]

Sign In for Pricing
View Details
SLAMF7 Polyclonal Antibody
RD86847A-01 60 μL

SLAMF7 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF7 Polyclonal Antibody
RD86847A-02 120 μL

SLAMF7 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF7 Polyclonal Antibody
RD86847A-03 200 µL

SLAMF7 Polyclonal Antibody

Sign In for Pricing
View Details
Mcl-1 (phospho-Ser64) rabbit pAb
MBS8585934-01 0.1 mg

Mcl-1 (phospho-Ser64) rabbit pAb

Sign In for Pricing
View Details
Mcl-1 (phospho-Ser64) rabbit pAb
MBS8585934-02 0.1 mL (AF405L)

Mcl-1 (phospho-Ser64) rabbit pAb

Sign In for Pricing
View Details