Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSN3 Peptide - N-terminal region

CSN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSN10, CSNK, KCA

UniProt

P07498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSN3 Rabbit Polyclonal Antibody (orb581556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005203

Preservative

Lyophilized powder

AA Sequence

MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC9A (C-type Lectin Domain Family 9 Member A, DNGR1, HEEE9341, UNQ9341, UNQ9341/PRO34046) (MaxLight 650)
MBS6374123-01 0.1 mL

CLEC9A (C-type Lectin Domain Family 9 Member A, DNGR1, HEEE9341, UNQ9341, UNQ9341/PRO34046) (MaxLight 650)

Sign In for Pricing
View Details
CLEC9A (C-type Lectin Domain Family 9 Member A, DNGR1, HEEE9341, UNQ9341, UNQ9341/PRO34046) (MaxLight 650)
MBS6374123-02 5x 0.1 mL

CLEC9A (C-type Lectin Domain Family 9 Member A, DNGR1, HEEE9341, UNQ9341, UNQ9341/PRO34046) (MaxLight 650)

Sign In for Pricing
View Details
PRR5 discontinued
531487-01 20 µL

PRR5 discontinued

Sign In for Pricing
View Details
PRR5 discontinued
531487-02 100 µL

PRR5 discontinued

Sign In for Pricing
View Details
Porcine Tyrosine ELISA kit
GTR10420229 96 Well

Porcine Tyrosine ELISA kit

Sign In for Pricing
View Details
CHRFAM7A Rabbit Polyclonal Antibody (C-Term)
E28PB3484 100 µL

CHRFAM7A Rabbit Polyclonal Antibody (C-Term)

Sign In for Pricing
View Details